250 hits for blastp blast on UNIPROTKB sorted by score descending
![]() | Download |
Filter
Graphical overview
Color code for identity 0-100% =

Accession | Entry name |
|
| Name (Organism) | ||||||
---|---|---|---|---|---|---|---|---|---|---|
Query 20111026305Y2PE8PS | ||||||||||
E8BLH5 | E8BLH5_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E8BHI1 | E8BHI1_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E8AUC7 | E8AUC7_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E8AR57 | E8AR57_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E8A943 | E8A943_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E8A3S2 | E8A3S2_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7ZHQ9 | E7ZHQ9_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7ZDH6 | E7ZDH6_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7YYX7 | E7YYX7_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7YR72 | E7YR72_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7Y9L7 | E7Y9L7_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7Y0D7 | E7Y0D7_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7XHI2 | E7XHI2_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7X4S3 | E7X4S3_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7X371 | E7X371_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7WQX0 | E7WQX0_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7WEB0 | E7WEB0_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7VTW2 | E7VTW2_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7VQH1 | E7VQH1_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
E7VC11 | E7VC11_SALMO | Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...) | ||||||||
B5CJP6 | B5CJP6_SALET | Acetyl-CoA carboxylase, biotin carbox... (Salmonella enterica subsp. enterica s...) | ||||||||
B5NJC6 | B5NJC6_SALET | Acetyl-CoA carboxylase, biotin carbox... (Salmonella enterica subsp. enterica s...) | ||||||||
C9XTG8 | C9XTG8_CROTZ | Biotin carboxyl carrier protein of ac... (Cronobacter turicensis (strain DSM 18...) | ||||||||
P0ABE1 | BCCP_SHIFL | Biotin carboxyl carrier protein of ac... (Shigella flexneri) | ||||||||
P0ABD8 | BCCP_ECOLI | Biotin carboxyl carrier protein of ac... (Escherichia coli (strain K12)) | ||||||||
P0ABD9 | BCCP_ECOL6 | Biotin carboxyl carrier protein of ac... (Escherichia coli O6) |
Detailed BLAST results Customize
› Show hits with 3D data only.
› Show hits from complete proteomes only .
Alignments | Entry | Entry name | Status | ![]() | Organism | ![]() | ![]() |
![]() |
![]() | ![]() | Protein existence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() | E8BLH5 | E8BLH5_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 609460 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM460_13492 | Predicted | |
![]() | E8BHI1 | E8BHI1_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM501_04319 | Predicted | |
![]() | E8AUC7 | E8AUC7_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM581_06834 | Predicted | |
![]() | E8AR57 | E8AR57_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 446600 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM600_19871 | Predicted | |
![]() | E8A943 | E8A943_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 413180 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM180_01172 | Predicted | |
![]() | E8A3S2 | E8A3S2_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 366867 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM867_11539 | Predicted | |
![]() | E7ZHQ9 | E7ZHQ9_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 414877 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM877_11819 | Predicted | |
![]() | E7ZDH6 | E7ZDH6_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM507_15005 | Predicted | |
![]() | E7YYX7 | E7YYX7_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM801_03751 | Predicted | |
![]() | E7YR72 | E7YR72_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 19N | 156 | 99.0% | 765 | 1.0×10-79 | SEEM19N_05403 | Predicted | |
![]() | E7Y9L7 | E7Y9L7_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM965_01394 | Predicted | |
![]() | E7Y0D7 | E7Y0D7_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM675_08230 | Predicted | |
![]() | E7XHI2 | E7XHI2_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM054_12365 | Predicted | |
![]() | E7X4S3 | E7X4S3_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 531954 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM954_06528 | Predicted | |
![]() | E7X371 | E7X371_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM202_21678 | Predicted | |
![]() | E7WQX0 | E7WQX0_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM201_10699 | Predicted | |
![]() | E7WEB0 | E7WEB0_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM974_16614 | Predicted | |
![]() | E7VTW2 | E7VTW2_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM973_10371 | Predicted | |
![]() | E7VQH1 | E7VQH1_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM971_02990 | Predicted | |
![]() | E7VC11 | E7VC11_SALMO | ![]() | Acetyl-CoA carboxylase
biotin carboxyl carrie... | Salmonella enterica subsp. enterica serovar Montevideo str. 315996572 | 156 | 99.0% | 765 | 1.0×10-79 | SEEM315_17157 | Predicted | |
![]() | B5CJP6 | B5CJP6_SALET | ![]() | Acetyl-CoA carboxylase,
biotin carboxyl carri... | Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 | 156 | 99.0% | 765 | 1.0×10-79 | accB SeSB_A3737 | Predicted | |
![]() | B5NJC6 | B5NJC6_SALET | ![]() | Acetyl-CoA carboxylase,
biotin carboxyl carri... | Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 | 156 | 98.0% | 757 | 1.0×10-78 | accB SeJ_A3855 | Predicted | |
![]() | C9XTG8 | C9XTG8_CROTZ | ![]() | Biotin carboxyl carrier
protein of acetyl-CoA... | Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032) | 157 | 92.0% | 722 | 1.0×10-74 | accB Ctu_03330 CTU_03330 | Predicted | |
![]() | P0ABE1 | BCCP_SHIFL | ![]() | Biotin carboxyl carrier
protein of acetyl-CoA... | Shigella flexneri | 156 | 92.0% | 715 | 8.0×10-74 | accB SF3293 S3510 | Inferred from homology | |
![]() | P0ABD8 | BCCP_ECOLI | ![]() | Biotin carboxyl carrier
protein of acetyl-CoA... | Escherichia coli (strain K12) | 156 | 92.0% | 715 | 8.0×10-74 | accB fabE b3255 JW3223 | Evidence at protein level | |
![]() | P0ABD9 | BCCP_ECOL6 | ![]() | Biotin carboxyl carrier
protein of acetyl-CoA... | Escherichia coli O6 | 156 | 92.0% | 715 | 8.0×10-74 | accB c4011 | Inferred from homology |
Job information
Query sequence | >tr|Q8XGD9|Q8XGD9_SALTI Biotin carboxyl carrier protein OS=Salmonella typhi GN=accB PE=4 SV=1 MDIRKIKKLIELVEESGISELEISEGEESVRISRTTANAGFPVMQQAYAAPMMQQPALSN AVAPAATPAMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEA MKMMNQIEADKAGTVKAILVESGQPVEFDEPLVVIE |
Date of job execution | Oct 26, 2011 |
Running time | 23 seconds |
Program | blastp (BLASTP 2.2.25 [Feb-01-2011]) |
Database | uniprotkb (Protein) generated for BLAST on Oct 18, 2011 |
Sequences | 18,215,249 sequences consisting of 5,955,376,296 letters |
Matrix | blosum62 |
Threshold | 10 |
Filtered | false |
Gapped | true |
Maximum number of hits reported | 250 |