Skip Header

250 hits for blastp blast on UNIPROTKB sorted by score descending

Filter

Dataset Taxonomy

Graphical overview

Color code for identity 0-100% =
AccessionEntry name
0Query hit296
0Match hit (sqrt scale)311
Name (Organism)
Query 2011102830653XA5JZ
D2TL22 D2TL22_CITRI Protoheme IX farnesyltransferase (Citrobacter rodentium (strain ICC168))
D8A661 D8A661_ECOLX Protoheme IX farnesyltransferase (Escherichia coli MS 21-1)
Q325H3 CYOE_SHIBS Protoheme IX farnesyltransferase (Shigella boydii serotype 4 (strain Sb227))
B1LJI2 CYOE_ECOSM Protoheme IX farnesyltransferase (Escherichia coli (strain SMS-3-5 / SECEC))
P0AEA5 CYOE_ECOLI Protoheme IX farnesyltransferase (Escherichia coli (strain K12))
B1J021 CYOE_ECOLC Protoheme IX farnesyltransferase (Escherichia coli (strain ATCC 8739 / ...)
P0AEA6 CYOE_ECOL6 Protoheme IX farnesyltransferase (Escherichia coli O6)
A7ZX84 CYOE_ECOHS Protoheme IX farnesyltransferase (Escherichia coli O9:H4 (strain HS))
B1XFL6 CYOE_ECODH Protoheme IX farnesyltransferase (Escherichia coli (strain K12 / DH10B))
P0AEA7 CYOE_ECO57 Protoheme IX farnesyltransferase (Escherichia coli O157:H7)
A7ZII5 CYOE_ECO24 Protoheme IX farnesyltransferase (Escherichia coli O139:H28 (strain E24...)
A8AK26 CYOE_CITK8 Protoheme IX farnesyltransferase (Citrobacter koseri (strain ATCC BAA-8...)
E8Y8P5 E8Y8P5_ECOKO Protoheme IX farnesyltransferase (Escherichia coli (strain ATCC 55124 / KO11))
E3PFP5 E3PFP5_ECOH1 Protoheme IX farnesyltransferase (Escherichia coli O78:H11 (strain H104...)
E1PA25 E1PA25_ECOAB Protoheme IX farnesyltransferase (Escherichia coli OR:K5:H- (strain ABU...)
E0J0K8 E0J0K8_ECOLW Protoheme IX farnesyltransferase (Escherichia coli (strain ATCC 9637 / ...)
D3QJJ9 D3QJJ9_ECOCB Protoheme IX farnesyltransferase (Escherichia coli O55:H7 (strain CB961...)
C9QQ90 C9QQ90_ECOD1 Protoheme IX farnesyltransferase (Escherichia coli (strain ATCC 33849 /...)
C8UIL2 C8UIL2_ECO1A Protoheme IX farnesyltransferase (Escherichia coli O111:H- (strain 1112...)
C8U2B5 C8U2B5_ECO10 Protoheme IX farnesyltransferase (Escherichia coli O103:H2 (strain 1200...)
C8TJ21 C8TJ21_ECO26 Protoheme IX farnesyltransferase (Escherichia coli O26:H11 (strain 1136...)
C6UZ67 C6UZ67_ECO5T Protoheme IX farnesyltransferase (Escherichia coli O157:H7 (strain TW14...)
C6UBP3 C6UBP3_ECOBR Protoheme IX farnesyltransferase (Escherichia coli (strain B / REL606))
C6EL38 C6EL38_ECOBD Protoheme IX farnesyltransferase (Escherichia coli (strain B / BL21-DE3))
C4ZTI5 C4ZTI5_ECOBW Protoheme IX farnesyltransferase (Escherichia coli (strain K12 / MC4100...)
B7NJ66 B7NJ66_ECO7I Protoheme IX farnesyltransferase (Escherichia coli O7:K1 (strain IAI39 ...)

Detailed BLAST results Customize

› Show hits from complete proteomes only .

 Alignments Entry Entry name Status Show full text Protein names Organism Length Identity Score E-value Gene names Protein existence
D2TL22D2TL22_CITRI
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Citrobacter rodentium (strain ICC168) (Citrobacter freundii biotype 4280)29695.0%1,4751.0×10-161cyoE ROD_04841Inferred from homology
D8A661D8A661_ECOLX
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli MS 21-129695.0%1,4671.0×10-160cyoE HMPREF9530_02006Inferred from homology
Q325H3CYOE_SHIBS
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Shigella boydii serotype 4 (strain Sb227)29695.0%1,4661.0×10-160cyoE SBO_0322Inferred from homology
B1LJI2CYOE_ECOSM
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain SMS-3-5 / SECEC)29695.0%1,4661.0×10-160cyoE EcSMS35_0468Inferred from homology
P0AEA5CYOE_ECOLI
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain K12)29695.0%1,4661.0×10-160cyoE b0428 JW0418Evidence at protein level
B1J021CYOE_ECOLC
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)29695.0%1,4661.0×10-160cyoE EcolC_3205Inferred from homology
P0AEA6CYOE_ECOL6
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O629695.0%1,4661.0×10-160cyoE c0539Inferred from homology
A7ZX84CYOE_ECOHS
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O9:H4 (strain HS)29695.0%1,4661.0×10-160cyoE EcHS_A0503Inferred from homology
B1XFL6CYOE_ECODH
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain K12 / DH10B)29695.0%1,4661.0×10-160cyoE ECDH10B_0384Inferred from homology
P0AEA7CYOE_ECO57
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O157:H729695.0%1,4661.0×10-160cyoE Z0531 ECs0482Inferred from homology
A7ZII5CYOE_ECO24
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O139:H28 (strain E24377A / ETEC)29695.0%1,4661.0×10-160cyoE EcE24377A_0463Inferred from homology
A8AK26CYOE_CITK8
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)29695.0%1,4661.0×10-160cyoE CKO_02733Inferred from homology
E8Y8P5E8Y8P5_ECOKO
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain ATCC 55124 / KO11)29695.0%1,4661.0×10-160cyoE EKO11_3418Inferred from homology
E3PFP5E3PFP5_ECOH1
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O78:H11 (strain H10407 / ETEC)29695.0%1,4661.0×10-160cyoE ETEC_0481Inferred from homology
E1PA25E1PA25_ECOAB
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli OR:K5:H- (strain ABU 83972)29695.0%1,4661.0×10-160cyoE ECABU_c05070Inferred from homology
E0J0K8E0J0K8_ECOLW
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / NCIMB 8666 / NRRL B-766 / W)29695.0%1,4661.0×10-160cyoE ECW_m0500 EschWDRAFT_2136Inferred from homology
D3QJJ9D3QJJ9_ECOCB
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O55:H7 (strain CB9615 / EPEC)29695.0%1,4661.0×10-160cyoE G2583_0540Inferred from homology
C9QQ90C9QQ90_ECOD1
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIB 12045 / K12 / DH1)29695.0%1,4661.0×10-160cyoE EcDH1_3181 ECDH1ME8569_0413Inferred from homology
C8UIL2C8UIL2_ECO1A
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O111:H- (strain 11128 / EHEC)29695.0%1,4661.0×10-160cyoE ECO111_0461Inferred from homology
C8U2B5C8U2B5_ECO10
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O103:H2 (strain 12009 / EHEC)29695.0%1,4661.0×10-160cyoE ECO103_0405Inferred from homology
C8TJ21C8TJ21_ECO26
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O26:H11 (strain 11368 / EHEC)29695.0%1,4661.0×10-160cyoE ECO26_0463Inferred from homology
C6UZ67C6UZ67_ECO5T
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O157:H7 (strain TW14359 / EHEC)29695.0%1,4661.0×10-160cyoE ECSP_0496Inferred from homology
C6UBP3C6UBP3_ECOBR
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain B / REL606)29695.0%1,4661.0×10-160cyoE ECB_00379Inferred from homology
C6EL38C6EL38_ECOBD
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain B / BL21-DE3)29695.0%1,4661.0×10-160cyoE B21_00383 ECBD_3230 ECD_00379Inferred from homology
C4ZTI5C4ZTI5_ECOBW
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli (strain K12 / MC4100 / BW2952)29695.0%1,4661.0×10-160cyoE BWG_0310Inferred from homology
B7NJ66B7NJ66_ECO7I
Protoheme IX farnesyltransferase
Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B farnesyltransferase) (Heme O synthase)
Escherichia coli O7:K1 (strain IAI39 / ExPEC)29695.0%1,4661.0×10-160cyoE ECIAI39_0245Inferred from homology

Job information

Query sequence
>sp|Q8Z8V5|CYOE_SALTI Protoheme IX farnesyltransferase OS=Salmonella typhi GN=cyoE PE=3 SV=1
MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGVSLVVASGCVFNNYI
DRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWFGANPLACWLGVMGFVVY
VGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAAILLAIFSLWQMPHSYAI
AIFRFKDYQAANIPVLPVIKGISVAKNHITLYIIAFAVATLMLTLGGYAGYKYLVVAAAV
SVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSIMMSVDFMVPNSQNLLTYVW
Date of job executionOct 28, 2011
Running time1.9 seconds
Programblastp (BLASTP 2.2.25 [Feb-01-2011])
Database uniprotkb (Protein) generated for BLAST on Oct 18, 2011
Sequences18,215,249 sequences consisting of 5,955,376,296 letters
Matrix blosum62
Threshold10
Filteredfalse
Gappedtrue
Maximum number of hits reported250
to top of page·

« Previous | Page of 10 | Next »

Filter·Overview·Results·Job information