Skip Header

250 hits for blastp blast on UNIPROTKB sorted by score descending

Filter

Dataset Taxonomy

Graphical overview

Color code for identity 0-100% =
AccessionEntry name
0Query hit156
0Match hit (sqrt scale)158
Name (Organism)
Query 20111026305Y2PE8PS
E8BLH5 E8BLH5_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E8BHI1 E8BHI1_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E8AUC7 E8AUC7_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E8AR57 E8AR57_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E8A943 E8A943_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E8A3S2 E8A3S2_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7ZHQ9 E7ZHQ9_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7ZDH6 E7ZDH6_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7YYX7 E7YYX7_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7YR72 E7YR72_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7Y9L7 E7Y9L7_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7Y0D7 E7Y0D7_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7XHI2 E7XHI2_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7X4S3 E7X4S3_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7X371 E7X371_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7WQX0 E7WQX0_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7WEB0 E7WEB0_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7VTW2 E7VTW2_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7VQH1 E7VQH1_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
E7VC11 E7VC11_SALMO Acetyl-CoA carboxylase biotin carboxy... (Salmonella enterica subsp. enterica s...)
B5CJP6 B5CJP6_SALET Acetyl-CoA carboxylase, biotin carbox... (Salmonella enterica subsp. enterica s...)
B5NJC6 B5NJC6_SALET Acetyl-CoA carboxylase, biotin carbox... (Salmonella enterica subsp. enterica s...)
C9XTG8 C9XTG8_CROTZ Biotin carboxyl carrier protein of ac... (Cronobacter turicensis (strain DSM 18...)
P0ABE1 BCCP_SHIFL Biotin carboxyl carrier protein of ac... (Shigella flexneri)
P0ABD8 BCCP_ECOLI Biotin carboxyl carrier protein of ac... (Escherichia coli (strain K12))
P0ABD9 BCCP_ECOL6 Biotin carboxyl carrier protein of ac... (Escherichia coli O6)

Detailed BLAST results Customize

› Show hits with 3D data only.

› Show hits from complete proteomes only .

 Alignments Entry Entry name Status Show full text Protein names Organism Length Identity Score E-value Gene names Protein existence
E8BLH5E8BLH5_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 60946015699.0%7651.0×10-79 SEEM460_13492Predicted
E8BHI1E8BHI1_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 556150-115699.0%7651.0×10-79 SEEM501_04319Predicted
E8AUC7E8AUC7_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 609458-115699.0%7651.0×10-79 SEEM581_06834Predicted
E8AR57E8AR57_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 44660015699.0%7651.0×10-79 SEEM600_19871Predicted
E8A943E8A943_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 41318015699.0%7651.0×10-79 SEEM180_01172Predicted
E8A3S2E8A3S2_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 36686715699.0%7651.0×10-79 SEEM867_11539Predicted
E7ZHQ9E7ZHQ9_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 41487715699.0%7651.0×10-79 SEEM877_11819Predicted
E7ZDH6E7ZDH6_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA0924950715699.0%7651.0×10-79 SEEM507_15005Predicted
E7YYX7E7YYX7_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 81038-0115699.0%7651.0×10-79 SEEM801_03751Predicted
E7YR72E7YR72_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 19N15699.0%7651.0×10-79 SEEM19N_05403Predicted
E7Y9L7E7Y9L7_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH1596515699.0%7651.0×10-79 SEEM965_01394Predicted
E7Y0D7E7Y0D7_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. OH_200907267515699.0%7651.0×10-79 SEEM675_08230Predicted
E7XHI2E7XHI2_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-005415699.0%7651.0×10-79 SEEM054_12365Predicted
E7X4S3E7X4S3_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 53195415699.0%7651.0×10-79 SEEM954_06528Predicted
E7X371E7X371_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 515920-215699.0%7651.0×10-79 SEEM202_21678Predicted
E7WQX0E7WQX0_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 515920-115699.0%7651.0×10-79 SEEM201_10699Predicted
E7WEB0E7WEB0_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 495297-415699.0%7651.0×10-79 SEEM974_16614Predicted
E7VTW2E7VTW2_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 495297-315699.0%7651.0×10-79 SEEM973_10371Predicted
E7VQH1E7VQH1_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 495297-115699.0%7651.0×10-79 SEEM971_02990Predicted
E7VC11E7VC11_SALMO
Acetyl-CoA carboxylase biotin carboxyl carrie...
Salmonella enterica subsp. enterica serovar Montevideo str. 31599657215699.0%7651.0×10-79 SEEM315_17157Predicted
B5CJP6B5CJP6_SALET
Acetyl-CoA carboxylase, biotin carboxyl carri...
Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL48015699.0%7651.0×10-79accB SeSB_A3737Predicted
B5NJC6B5NJC6_SALET
Acetyl-CoA carboxylase, biotin carboxyl carri...
Salmonella enterica subsp. enterica serovar Javiana str. GA_MM0404243315698.0%7571.0×10-78accB SeJ_A3855Predicted
C9XTG8C9XTG8_CROTZ
Biotin carboxyl carrier protein of acetyl-CoA...
Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032)15792.0%7221.0×10-74accB Ctu_03330 CTU_03330Predicted
P0ABE1BCCP_SHIFL
Biotin carboxyl carrier protein of acetyl-CoA...
Shigella flexneri15692.0%7158.0×10-74accB SF3293 S3510Inferred from homology
P0ABD8BCCP_ECOLI
Biotin carboxyl carrier protein of acetyl-CoA...
Escherichia coli (strain K12)15692.0%7158.0×10-74accB fabE b3255 JW3223Evidence at protein level
P0ABD9BCCP_ECOL6
Biotin carboxyl carrier protein of acetyl-CoA...
Escherichia coli O615692.0%7158.0×10-74accB c4011Inferred from homology

Job information

Query sequence
>tr|Q8XGD9|Q8XGD9_SALTI Biotin carboxyl carrier protein OS=Salmonella typhi GN=accB PE=4 SV=1
MDIRKIKKLIELVEESGISELEISEGEESVRISRTTANAGFPVMQQAYAAPMMQQPALSN
AVAPAATPAMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEA
MKMMNQIEADKAGTVKAILVESGQPVEFDEPLVVIE
Date of job executionOct 26, 2011
Running time23 seconds
Programblastp (BLASTP 2.2.25 [Feb-01-2011])
Database uniprotkb (Protein) generated for BLAST on Oct 18, 2011
Sequences18,215,249 sequences consisting of 5,955,376,296 letters
Matrix blosum62
Threshold10
Filteredfalse
Gappedtrue
Maximum number of hits reported250
to top of page·

« Previous | Page of 10 | Next »

Filter·Overview·Results·Job information