250 hits for blastp blast on UNIPROTKB sorted by score descending
![]() | Download |
Filter
Graphical overview
Color code for identity 0-100% =

Accession | Entry name |
|
| Name (Organism) | ||||||
---|---|---|---|---|---|---|---|---|---|---|
Query 2011102830653XA5JZ | ||||||||||
D2TL22 | D2TL22_CITRI | Protoheme IX farnesyltransferase (Citrobacter rodentium (strain ICC168)) | ||||||||
D8A661 | D8A661_ECOLX | Protoheme IX farnesyltransferase (Escherichia coli MS 21-1) | ||||||||
Q325H3 | CYOE_SHIBS | Protoheme IX farnesyltransferase (Shigella boydii serotype 4 (strain Sb227)) | ||||||||
B1LJI2 | CYOE_ECOSM | Protoheme IX farnesyltransferase (Escherichia coli (strain SMS-3-5 / SECEC)) | ||||||||
P0AEA5 | CYOE_ECOLI | Protoheme IX farnesyltransferase (Escherichia coli (strain K12)) | ||||||||
B1J021 | CYOE_ECOLC | Protoheme IX farnesyltransferase (Escherichia coli (strain ATCC 8739 / ...) | ||||||||
P0AEA6 | CYOE_ECOL6 | Protoheme IX farnesyltransferase (Escherichia coli O6) | ||||||||
A7ZX84 | CYOE_ECOHS | Protoheme IX farnesyltransferase (Escherichia coli O9:H4 (strain HS)) | ||||||||
B1XFL6 | CYOE_ECODH | Protoheme IX farnesyltransferase (Escherichia coli (strain K12 / DH10B)) | ||||||||
P0AEA7 | CYOE_ECO57 | Protoheme IX farnesyltransferase (Escherichia coli O157:H7) | ||||||||
A7ZII5 | CYOE_ECO24 | Protoheme IX farnesyltransferase (Escherichia coli O139:H28 (strain E24...) | ||||||||
A8AK26 | CYOE_CITK8 | Protoheme IX farnesyltransferase (Citrobacter koseri (strain ATCC BAA-8...) | ||||||||
E8Y8P5 | E8Y8P5_ECOKO | Protoheme IX farnesyltransferase (Escherichia coli (strain ATCC 55124 / KO11)) | ||||||||
E3PFP5 | E3PFP5_ECOH1 | Protoheme IX farnesyltransferase (Escherichia coli O78:H11 (strain H104...) | ||||||||
E1PA25 | E1PA25_ECOAB | Protoheme IX farnesyltransferase (Escherichia coli OR:K5:H- (strain ABU...) | ||||||||
E0J0K8 | E0J0K8_ECOLW | Protoheme IX farnesyltransferase (Escherichia coli (strain ATCC 9637 / ...) | ||||||||
D3QJJ9 | D3QJJ9_ECOCB | Protoheme IX farnesyltransferase (Escherichia coli O55:H7 (strain CB961...) | ||||||||
C9QQ90 | C9QQ90_ECOD1 | Protoheme IX farnesyltransferase (Escherichia coli (strain ATCC 33849 /...) | ||||||||
C8UIL2 | C8UIL2_ECO1A | Protoheme IX farnesyltransferase (Escherichia coli O111:H- (strain 1112...) | ||||||||
C8U2B5 | C8U2B5_ECO10 | Protoheme IX farnesyltransferase (Escherichia coli O103:H2 (strain 1200...) | ||||||||
C8TJ21 | C8TJ21_ECO26 | Protoheme IX farnesyltransferase (Escherichia coli O26:H11 (strain 1136...) | ||||||||
C6UZ67 | C6UZ67_ECO5T | Protoheme IX farnesyltransferase (Escherichia coli O157:H7 (strain TW14...) | ||||||||
C6UBP3 | C6UBP3_ECOBR | Protoheme IX farnesyltransferase (Escherichia coli (strain B / REL606)) | ||||||||
C6EL38 | C6EL38_ECOBD | Protoheme IX farnesyltransferase (Escherichia coli (strain B / BL21-DE3)) | ||||||||
C4ZTI5 | C4ZTI5_ECOBW | Protoheme IX farnesyltransferase (Escherichia coli (strain K12 / MC4100...) | ||||||||
B7NJ66 | B7NJ66_ECO7I | Protoheme IX farnesyltransferase (Escherichia coli O7:K1 (strain IAI39 ...) |
Detailed BLAST results Customize
› Show hits from complete proteomes only .
Alignments | Entry | Entry name | Status | ![]() | Organism | ![]() | ![]() |
![]() |
![]() | ![]() | Protein existence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() | D2TL22 | D2TL22_CITRI | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Citrobacter rodentium (strain ICC168) (Citrobacter freundii biotype 4280) | 296 | 95.0% | 1,475 | 1.0×10-161 | cyoE ROD_04841 | Inferred from homology | |
![]() | D8A661 | D8A661_ECOLX | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli MS 21-1 | 296 | 95.0% | 1,467 | 1.0×10-160 | cyoE HMPREF9530_02006 | Inferred from homology | |
![]() | Q325H3 | CYOE_SHIBS | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Shigella boydii serotype 4 (strain Sb227) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE SBO_0322 | Inferred from homology | |
![]() | B1LJI2 | CYOE_ECOSM | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Escherichia coli (strain SMS-3-5 / SECEC) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE EcSMS35_0468 | Inferred from homology | |
![]() | P0AEA5 | CYOE_ECOLI | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Escherichia coli (strain K12) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE b0428 JW0418 | Evidence at protein level | |
![]() | B1J021 | CYOE_ECOLC | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE EcolC_3205 | Inferred from homology | |
![]() | P0AEA6 | CYOE_ECOL6 | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Escherichia coli O6 | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE c0539 | Inferred from homology | |
![]() | A7ZX84 | CYOE_ECOHS | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Escherichia coli O9:H4 (strain HS) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE EcHS_A0503 | Inferred from homology | |
![]() | B1XFL6 | CYOE_ECODH | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Escherichia coli (strain K12 / DH10B) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ECDH10B_0384 | Inferred from homology | |
![]() | P0AEA7 | CYOE_ECO57 | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Escherichia coli O157:H7 | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE Z0531 ECs0482 | Inferred from homology | |
![]() | A7ZII5 | CYOE_ECO24 | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Escherichia coli O139:H28 (strain E24377A / ETEC) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE EcE24377A_0463 | Inferred from homology | |
![]() | A8AK26 | CYOE_CITK8 | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-)
(Heme B farnesyltransferase) (Heme O synthase) | Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE CKO_02733 | Inferred from homology | |
![]() | E8Y8P5 | E8Y8P5_ECOKO | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli (strain ATCC 55124 / KO11) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE EKO11_3418 | Inferred from homology | |
![]() | E3PFP5 | E3PFP5_ECOH1 | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli O78:H11 (strain H10407 / ETEC) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ETEC_0481 | Inferred from homology | |
![]() | E1PA25 | E1PA25_ECOAB | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli OR:K5:H- (strain ABU 83972) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ECABU_c05070 | Inferred from homology | |
![]() | E0J0K8 | E0J0K8_ECOLW | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / NCIMB 8666 / NRRL B-766 / W) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ECW_m0500 EschWDRAFT_2136 | Inferred from homology | |
![]() | D3QJJ9 | D3QJJ9_ECOCB | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli O55:H7 (strain CB9615 / EPEC) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE G2583_0540 | Inferred from homology | |
![]() | C9QQ90 | C9QQ90_ECOD1 | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIB 12045 / K12 / DH1) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE EcDH1_3181 ECDH1ME8569_0413 | Inferred from homology | |
![]() | C8UIL2 | C8UIL2_ECO1A | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli O111:H- (strain 11128 / EHEC) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ECO111_0461 | Inferred from homology | |
![]() | C8U2B5 | C8U2B5_ECO10 | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli O103:H2 (strain 12009 / EHEC) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ECO103_0405 | Inferred from homology | |
![]() | C8TJ21 | C8TJ21_ECO26 | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli O26:H11 (strain 11368 / EHEC) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ECO26_0463 | Inferred from homology | |
![]() | C6UZ67 | C6UZ67_ECO5T | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli O157:H7 (strain TW14359 / EHEC) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ECSP_0496 | Inferred from homology | |
![]() | C6UBP3 | C6UBP3_ECOBR | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli (strain B / REL606) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ECB_00379 | Inferred from homology | |
![]() | C6EL38 | C6EL38_ECOBD | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli (strain B / BL21-DE3) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE B21_00383 ECBD_3230 ECD_00379 | Inferred from homology | |
![]() | C4ZTI5 | C4ZTI5_ECOBW | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli (strain K12 / MC4100 / BW2952) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE BWG_0310 | Inferred from homology | |
![]() | B7NJ66 | B7NJ66_ECO7I | ![]() | Protoheme IX
farnesyltransferase Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme B
farnesyltransferase) (Heme O synthase) | Escherichia coli O7:K1 (strain IAI39 / ExPEC) | 296 | 95.0% | 1,466 | 1.0×10-160 | cyoE ECIAI39_0245 | Inferred from homology |
Job information
Query sequence | >sp|Q8Z8V5|CYOE_SALTI Protoheme IX farnesyltransferase OS=Salmonella typhi GN=cyoE PE=3 SV=1 MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGVSLVVASGCVFNNYI DRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWFGANPLACWLGVMGFVVY VGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAAILLAIFSLWQMPHSYAI AIFRFKDYQAANIPVLPVIKGISVAKNHITLYIIAFAVATLMLTLGGYAGYKYLVVAAAV SVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSIMMSVDFMVPNSQNLLTYVW |
Date of job execution | Oct 28, 2011 |
Running time | 1.9 seconds |
Program | blastp (BLASTP 2.2.25 [Feb-01-2011]) |
Database | uniprotkb (Protein) generated for BLAST on Oct 18, 2011 |
Sequences | 18,215,249 sequences consisting of 5,955,376,296 letters |
Matrix | blosum62 |
Threshold | 10 |
Filtered | false |
Gapped | true |
Maximum number of hits reported | 250 |